GMSC10.90AA.287_926_831

Summary of this 90AA cluster, including consensus sequences, ecological annotation, quality evidence, and linked 100AA members.

This is a 90AA family-level cluster. In GMSC, 90AA and 100AA refer to catalogue identity thresholds rather than sequence length: 90AA groups related smORFs at 90% amino acid identity, while 100AA accessions are non-redundant sequence entries.

The linked 100AA members let you inspect the individual non-redundant sequences assigned to this family, while the taxonomy and habitat summarise the ecological context of the cluster.

Consensus sequences

Representative protein sequence (99 amino acids)

MNGGQGNMEKSVTLEEALKRIEELEKENAELREELEYYRNRKLSGRQKHNAKWMAIYNDFVVGYESGMTMVEIAKRNNVSERTIYRYKAYYDKMKKKEE

Legend

AHydrophobic (A, V, I, L, M)
AAromatic (F, W, Y)
APolar uncharged (S, T, N, Q, C)
APositive (K, R, H)
ANegative (D, E)
ASpecial (G, P)
AOther / unknown (X, U, O, *)

Consensus nucleotide sequence

ATGAATGGAGGACAAGGTAATATGGAGAAATCGGTAACACTTGAAGAGGCATTAAAAAGAATTGAGGAGTTGGAAAAAGAGAATGCAGAACTTCGGGAGGAATTGGAGTATTACAGAAATCGTAAATTAAGCGGACGGCAGAAACATAACGCCAAGTGGATGGCAATTTATAATGATTTTGTTGTTGGGTATGAGAGTGGCATGACAATGGTAGAAATTGCGAAGCGGAACAATGTCAGTGAGAGGACGATCTATAGGTATAAAGCGTATTATGACAAAATGAAGAAAAAAGAGGAATAG

Annotations

Taxonomic assignment

Bacteria (domain)

Habitat

activated sludge,built environment,cat gut,cattle associated,cattle gut,cattle rumen,dog gut,goat rumen,human gut,human mouth,human skin,isolate,pig gut,primate gut,rat gut,soil,wastewater,water associated

Quality overview
High quality is defined as: Pass all in silico quality tests (Not in Antifam database, Pass the terminal checking, P-value of RNAcode < 0.05) and contained at least one item of experimental evidence (Align to at least 2 metatranscriptomic samples, alignment to at least 2 Riboseq samples, or the coverage of metaproteomic peptides on small protein sequences >0.5)

Not high quality

Review the detailed quality checks below to understand the evidence supporting this cluster.

Cluster members

Load the 100AA non-redundant smORF accessions assigned to this 90AA family to inspect their sequences, habitats, and taxonomy.


For more information, see (Duan et al., 2024).

Copyright (c) 2023-2026 GMSC authors. All rights reserved.