GMSC10.90AA.287_926_859

Summary of this 90AA cluster, including consensus sequences, ecological annotation, quality evidence, and linked 100AA members.

This is a 90AA family-level cluster. In GMSC, 90AA and 100AA refer to catalogue identity thresholds rather than sequence length: 90AA groups related smORFs at 90% amino acid identity, while 100AA accessions are non-redundant sequence entries.

The linked 100AA members let you inspect the individual non-redundant sequences assigned to this family, while the taxonomy and habitat summarise the ecological context of the cluster.

Consensus sequences

Representative protein sequence (99 amino acids)

MLAFEKVLKVFQAYLDDDPLYEVVQTSHGYTLMAWEPHRNDWYSAEIQKTPEDLRNALLGTYANFLEDKITGNDRDLTVTETGEIQQRCQELLEKCREP

Legend

AHydrophobic (A, V, I, L, M)
AAromatic (F, W, Y)
APolar uncharged (S, T, N, Q, C)
APositive (K, R, H)
ANegative (D, E)
ASpecial (G, P)
AOther / unknown (X, U, O, *)

Consensus nucleotide sequence

ATGCTGGCCTTTGAAAAGGTTTTGAAAGTGTTTCAGGCATATCTGGATGATGACCCTCTGTATGAGGTGGTTCAGACCAGTCATGGTTATACATTGATGGCATGGGAACCCCACCGGAATGACTGGTACAGCGCTGAAATACAGAAAACCCCGGAGGATTTACGGAACGCTTTGTTGGGTACATACGCCAACTTTCTGGAAGATAAGATTACTGGAAATGACCGTGACCTGACTGTGACAGAAACCGGAGAAATCCAGCAGAGGTGTCAGGAACTTTTGGAAAAGTGCCGGGAACCTTGA

Annotations

Taxonomic assignment

Bacteria (domain)

Habitat

activated sludge,air,bird gut,built environment,cat gut,cattle associated,cattle gut,cattle rumen,chicken gut,dog gut,human gut,human mouth,human respiratory tract,human saliva,human skin,isolate,mouse gut,pig gut,primate gut,rat gut,river associated,soil,wastewater,water associated

Quality overview
High quality is defined as: Pass all in silico quality tests (Not in Antifam database, Pass the terminal checking, P-value of RNAcode < 0.05) and contained at least one item of experimental evidence (Align to at least 2 metatranscriptomic samples, alignment to at least 2 Riboseq samples, or the coverage of metaproteomic peptides on small protein sequences >0.5)

Not high quality

Review the detailed quality checks below to understand the evidence supporting this cluster.

Cluster members

Load the 100AA non-redundant smORF accessions assigned to this 90AA family to inspect their sequences, habitats, and taxonomy.


For more information, see (Duan et al., 2024).

Copyright (c) 2023-2026 GMSC authors. All rights reserved.